
IGF-1 LR3 1mg arrived with clear documentation, intact packaging and a batch-specific COA that made internal receipt checks straightforward.
For 10 Points, get 10% discount upto €100 per order. Become an Influencer by referring to at least 10 friends and get 10% off every order you make

LL-37 5mg is a highly specialised antimicrobial peptide from the cathelicidin family, researched for its broad-spectrum activity against bacteria, viruses, and fungi. By mimicking innate immune responses, LL-37 supports studies on membrane disruption, immune modulation, and wound healing processes. Its amphipathic alpha-helical structure makes it a key compound for investigators exploring host defence mechanisms and anti-infective strategies.
LL-37 5mg is frequently examined in models of microbial infection, inflammation, or tissue repair. Its 37-amino-acid sequence enables rapid interaction with lipid membranes, making it suitable for research into antimicrobial resistance, angiogenesis promotion, and chemokine induction under stress conditions. Due to its multifunctional properties, LL-37 is often selected for studies on epithelial barrier function, endotoxin neutralisation, and immune cell recruitment in various disease contexts.
Antimicrobial Action – Targets microbial membranes to support studies on bacterial killing and biofilm disruption
Immune Modulation – Used to examine chemokine release, angiogenesis, and wound repair mechanisms
Multifunctional peptide – Enables research into inflammation control, viral inhibition, and cellular signalling
Research Only – Intended for qualified professionals conducting advanced scientific investigation
LL-37 5mg |
|
| CAS Number | 154947-66-7 |
| Molar Mass | 4493 g/mol |
| Molecular Formula | C<sub>205</sub>H<sub>340</sub>N<sub>60</sub>O<sub>53</sub> |
| Sequence | [LL-37, 37 aa] |
All products featured on this site are intended solely for research purposes and are not for human or veterinary consumption under any circumstances. These materials are not classified as drugs, food products, cosmetics, or medicinal items.
By purchasing, the buyer accepts full responsibility for the safe handling, storage, and use of the compound, and confirms that they are a qualified professional conducting legitimate scientific work. Neither the distributor, manufacturer, nor seller shall be held liable for any misuse or outcome related to the use of this research material.
By completing your order, you confirm that:
You are over 18
You understand and accept our [Terms & Conditions]
You agree to handle all products in compliance with all applicable laws and safety standards.

IGF-1 LR3 1mg arrived with clear documentation, intact packaging and a batch-specific COA that made internal receipt checks straightforward.

AOD 9604 5mg was dispatched quickly and the labeling was precise. The published test data matched what our team expected from a research supplier.

AOD 9604 10mg was easy to verify against the listed batch information. Clean presentation, responsive support and smooth EU delivery.

Thymosin Alpha 1 10mg came with the level of traceability we need. The online certificate and packaging consistency were both very good.

Thymosin Alpha 1 Nasal Spray 10mg was packed securely and delivered on time. Useful product page details and a professional overall process.

GLOW 70mg pen order was handled efficiently and the quality paperwork was easy to review before purchase.

Selank Nasal Spray 10mg arrived with clear instructions and careful packing. The experience felt well organized from checkout to delivery.

Semax Nasal Spray 10mg was exactly as described. Strong communication, fast processing and transparent product documentation.

Our Berlin team ordered IGF-1 LR3 1mg and the process was excellent from checkout to delivery. The batch data was easy to review and the packaging arrived in very professional condition.
LL-37 5mg is a highly specialised antimicrobial peptide from the cathelicidin family, researched for its broad-spectrum activity against bacteria, viruses, and fungi. By mimicking innate immune responses, LL-37 supports studies on membrane disruption, immune modulation, and wound healing processes. Its amphipathic alpha-helical structure makes it a key compound for investigators exploring host defence mechanisms and anti-infective strategies.
LL-37 5mg is frequently examined in models of microbial infection, inflammation, or tissue repair. Its 37-amino-acid sequence enables rapid interaction with lipid membranes, making it suitable for research into antimicrobial resistance, angiogenesis promotion, and chemokine induction under stress conditions. Due to its multifunctional properties, LL-37 is often selected for studies on epithelial barrier function, endotoxin neutralisation, and immune cell recruitment in various disease contexts.
Antimicrobial Action – Targets microbial membranes to support studies on bacterial killing and biofilm disruption
Immune Modulation – Used to examine chemokine release, angiogenesis, and wound repair mechanisms
Multifunctional peptide – Enables research into inflammation control, viral inhibition, and cellular signalling
Research Only – Intended for qualified professionals conducting advanced scientific investigation
LL-37 5mg |
|
| CAS Number | 154947-66-7 |
| Molar Mass | 4493 g/mol |
| Molecular Formula | C<sub>205</sub>H<sub>340</sub>N<sub>60</sub>O<sub>53</sub> |
| Sequence | [LL-37, 37 aa] |
All products featured on this site are intended solely for research purposes and are not for human or veterinary consumption under any circumstances. These materials are not classified as drugs, food products, cosmetics, or medicinal items.
By purchasing, the buyer accepts full responsibility for the safe handling, storage, and use of the compound, and confirms that they are a qualified professional conducting legitimate scientific work. Neither the distributor, manufacturer, nor seller shall be held liable for any misuse or outcome related to the use of this research material.
By completing your order, you confirm that:
You are over 18
You understand and accept our [Terms & Conditions]
You agree to handle all products in compliance with all applicable laws and safety standards.
39.99 €
| Retartrutide | Full Reusable Pen Kit with 1 Pre Mixed cartridge 10mg, Peptide Reconstitution Pen Kit with 1 Lyophilized cartridge 10mg, Full Disposable Pen Kit with 1 Pre Mixed cartridge 10mg, Full Disposable Pen Kit with 1 Lyophilized Cartridge 10mg, 1 Pre Mixed Cartridge 10mg, 2 Pre Mixed Cartridges 10mg, 3 Pre Mixed Cartridges 10mg, 1 Lyophilized Cartridge 10mg, 2 Lyophilized Cartridges 10mg, 3 Lyophilized Cartridges 10mg |
|---|
Orders are shipped in plain, unbranded outer packaging with no product names or contents shown on the parcel.
4.8 out of 5 based on 81 reviews
See what customers say about Research Peptides Europe.
View All Reviews
{Research Peptides Europe}
Typically replies within minutes
Thanks for contacting Research Peptides Europe
How can we help you today ?
WhatsApp Us
🟢 Online | Privacy policy
WhatsApp us